Loading...
Statistics
Advertisement

arvrchina.com
www.arvrchina.com/

Arvrchina.com

Advertisement
Conversion Technology Metas Server
Arvrchina.com is hosted in United States / Portland . Arvrchina.com uses HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Php, Number of used javascripts: 0. First javascripts: Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.0.

Technologies in use by Arvrchina.com

Technology

Number of occurences: 3
  • CSS
  • Html
  • Php

Advertisement

Javascripts

Number of occurences: 0

Server Type

  • Microsoft-IIS/7.0

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Arvrchina.com

SSL certificate

    • name: /CN=www.ourdomains.com
    • subject:
      • CN: www.ourdomains.com
    • hash: 1d011d65
    • issuer:
      • C: US
      • O: thawte, Inc.
      • OU: Domain Validated SSL
      • CN: thawte DV SSL CA - G2
    • version: 2
    • serialNumber: 128777219009057701471460720087204766162
    • validFrom: 160628000000Z
    • validTo: 170728235959Z
    • validFrom_time_t: 1467072000
    • validTo_time_t: 1501286399
    • extensions:
      • subjectAltName: DNS:www.ourdomains.com, DNS:ourdomains.com
      • basicConstraints: CA:FALSE
      • crlDistributionPoints: Full Name: URI:http://tn.symcb.com/tn.crl
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.thawte.com/cps User Notice: Explicit Text: https://www.thawte.com/repository
      • authorityKeyIdentifier: keyid:9F:B8:C1:A9:6C:F2:F5:C0:22:2A:94:ED:5C:99:AC:D4:EC:D7:C6:07
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • authorityInfoAccess: OCSP - URI:http://tn.symcd.com CA Issuers - URI:http://tn.symcb.com/tn.crt
      • 1.3.6.1.4.1.11129.2.4.2: ðîuÝë+z O¦ ‹­hp~.ŽÕ\ˆ=ÄͶì¾ÌU–j-CF0D #¸Kf²APˆë„U=øÿˆûÆ÷„ªqÚí—„³ïã HӏsÒ ñw" 1bÜEX¥GFÐB±-¾s•M’º u¤¹ ´X‡»¢Ìgp <5˜ù߸ãwÍÈ ÜU–j-eF0D

Meta - Arvrchina.com

Number of occurences: 1
  • Name:
    Content: text/html; charset=utf-8

Server / Hosting

  • IP: 162.251.5.190
  • Latitude: 45.52
  • Longitude: -122.68
  • Country: United States
  • City: Portland

HTTP Header Response

HTTP/1.1 200 OK Cache-Control: private Content-Length: 3746 Content-Type: text/html; charset=utf-8 Server: Microsoft-IIS/7.0 X-AspNet-Version: 2.0.50727 X-Powered-By: ASP.NET Date: Fri, 30 Sep 2016 17:16:24 GMT X-Cache: MISS from s_wx1113 Via: 1.1 s_wx1113 (squid/3.5.20) Connection: keep-alive

DNS

host: arvrchina.com
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 162.251.5.190

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.rvrchina.com, www.aorvrchina.com, www.orvrchina.com, www.aprvrchina.com, www.prvrchina.com, www.a9rvrchina.com, www.9rvrchina.com, www.arvrchina.com, www.rvrchina.com, www.airvrchina.com, www.irvrchina.com, www.aurvrchina.com, www.urvrchina.com, www.avrchina.com, www.arivrchina.com, www.aivrchina.com, www.arovrchina.com, www.aovrchina.com, www.arlvrchina.com, www.alvrchina.com, www.arlvrchina.com, www.alvrchina.com, www.ar.vrchina.com, www.a.vrchina.com, www.arrchina.com, www.arvyrchina.com, www.aryrchina.com, www.arvzrchina.com, www.arzrchina.com, www.arvhrchina.com, www.arhrchina.com, www.arvnrchina.com, www.arnrchina.com, www.arvmrchina.com, www.armrchina.com, www.arvjrchina.com, www.arjrchina.com, www.arvkrchina.com, www.arkrchina.com, www.arvirchina.com, www.arirchina.com, www.arvchina.com, www.arvrichina.com, www.arvichina.com, www.arvrochina.com, www.arvochina.com, www.arvrlchina.com, www.arvlchina.com, www.arvrlchina.com, www.arvlchina.com, www.arvr.china.com, www.arv.china.com, www.arvrhina.com, www.arvrcdhina.com, www.arvrdhina.com, www.arvrcrhina.com, www.arvrrhina.com, www.arvrcthina.com, www.arvrthina.com, www.arvrcvhina.com, www.arvrvhina.com, www.arvrcfhina.com, www.arvrfhina.com, www.arvrcghina.com, www.arvrghina.com, www.arvrchhina.com, www.arvrhhina.com, www.arvrcnhina.com, www.arvrnhina.com, www.arvrcmhina.com, www.arvrmhina.com, www.arvrcjhina.com, www.arvrjhina.com, www.arvrcina.com, www.arvrcheina.com, www.arvrceina.com, www.arvrchdina.com, www.arvrcdina.com, www.arvrchcina.com, www.arvrccina.com, www.arvrchuina.com, www.arvrcuina.com, www.arvrchjina.com, www.arvrcjina.com, www.arvrchina.com, www.arvrcina.com, www.arvrchbina.com, www.arvrcbina.com, www.arvrchgina.com, www.arvrcgina.com, www.arvrchna.com, www.arvrchirna.com, www.arvrchrna.com, www.arvrchifna.com, www.arvrchfna.com, www.arvrchivna.com, www.arvrchvna.com, www.arvrchikna.com, www.arvrchkna.com, www.arvrchi,na.com, www.arvrch,na.com, www.arvrchibna.com, www.arvrchbna.com, www.arvrchigna.com, www.arvrchgna.com, www.arvrchitna.com, www.arvrchtna.com, www.arvrchiyna.com, www.arvrchyna.com, www.arvrchiuna.com, www.arvrchuna.com, www.arvrchijna.com, www.arvrchjna.com, www.arvrchimna.com, www.arvrchmna.com, www.arvrchinna.com, www.arvrchnna.com, www.arvrchia.com, www.arvrchinna.com, www.arvrchina.com, www.arvrchinha.com, www.arvrchiha.com, www.arvrchinja.com, www.arvrchija.com, www.arvrchinka.com, www.arvrchika.com, www.arvrchinla.com, www.arvrchila.com, www.arvrchin a.com, www.arvrchi a.com, www.arvrchin.com, www.arvrchinao.com, www.arvrchino.com, www.arvrchinap.com, www.arvrchinp.com, www.arvrchina9.com, www.arvrchin9.com, www.arvrchina.com, www.arvrchin.com, www.arvrchinai.com, www.arvrchini.com, www.arvrchinau.com, www.arvrchinu.com,

Other websites we recently analyzed

  1. sculptivated.com
    null
    United States - 75.98.17.66
    Server software: Webs.com/1.0
    Technology: CSS, Google Font API, Html, Html5, Javascript, Google Analytics, Add This
    Number of Javascript: 6
    Number of meta tags: 5
  2. ie565.com
    Hangzhou (China) - 123.56.199.69
    Server software: Microsoft-IIS/6.0
    Technology: Html, Php
    Number of Javascript: 1
    Number of meta tags: 1
  3. My Site
    Check out this GoDaddy hosted webpage! http://ssb-partners.com.
    Scottsdale (United States) - 97.74.42.79
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html, Javascript, jQuery, jQuery UI
    Number of Javascript: 4
    Number of meta tags: 3
  4. inderma.net
    Scottsdale (United States) - 184.168.221.63
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  5. Integrity Home & Commercial Inspection Services in Fort Worth, Texas
    Providence (United States) - 209.95.59.240
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Php, Webly
    Number of Javascript: 2
    Number of meta tags: 1
  6. Kasper & Kasper
    Berlin (Germany) - 81.169.145.162
    Server software: Apache
    Technology: CSS, Html, Javascript
    Number of meta tags: 1
  7. White Rose Amsterdam | White Rose Amsterdam
    Poland - 82.177.171.218
    Server software: Apache/2
    Technology: Font Awesome, Google Font API, Html, Html5, jQuery, Php, Pingback, SuperFish, Wordpress
    Number of Javascript: 8
    Number of meta tags: 3
  8. Cotton's Journey
    Cotton's Journey-A Field Trip in A Box - The only cotton education site for classroom teachers providing curriculum, literature resources, links to cotton and educational organizations promoting the importance of this crop, and the story of cotton-from seed to you.
    Visalia (United States) - 75.150.2.227
    Server software: Microsoft-IIS/5.0
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 3
  9. DUI in New Jersey - Experienced Traffic Ticket Attorney defense in NJ
    A local DUI Attorney can help you understand the specific DUI Laws in your State. Each State has different laws, penalties and fines when it comes to a DUI conviction.
    Red Bank (United States) - 96.234.32.5
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Html, Javascript, Swf Object, Google Analytics
    Number of Javascript: 4
    Number of meta tags: 10
  10. singletravelersmakingnewfriends.com
    United States - 192.195.77.18
    Server software: Apache
    Technology: Html
    Number of meta tags: 1

Check Other Websites